PPP4C antibody

Catalog No. ABIN631624

This Rabbit Polyclonal antibody specifically detects PPP4C in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for PPP4C antibody (ABIN631624)

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP4C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP4C Antibody

Purification: Affinity purified

Immunogen: PPP4 C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP4C Blocking Peptide, (ABIN5615527), is also available for use as a blocking control in assays to test for specificity of this PPP4C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP4C

Target: PPP4C (Protein Phosphatase 4, Catalytic Subunit (PPP4C))

Alternative Name: PPP4C

Background: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration.

Molecular Weight: 34 kDa (MW of target protein)