USP22 antibody (Middle Region)

Catalog No. ABIN631627

Product Details anti-USP22 Antibody

Target: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This USP22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: USP22 antibody was raised against the middle region of USP22

Purification: Affinity purified

Immunogen: USP22 antibody was raised using the middle region of USP22 corresponding to a region with amino acids PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

USP22 Blocking Peptide, catalog no. 33R-7372, is also available for use as a blocking control in assays to test for specificity of this USP22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for USP22

Target: USP22 (Ubiquitin Specific Peptidase 22 (USP22))

Alternative Name: USP22 (USP22 Products)

Synonyms: USP3L antibody, AI427806 antibody, zgc:136342 antibody, usp22 antibody, usp22 b antibody, usp22-B antibody, usp22-a antibody, usp3l antibody, ubiquitin specific peptidase 22 antibody, ubiquitin specific peptidase 22 S homeolog antibody, USP22 antibody, Usp22 antibody, usp22 antibody, usp22.S antibody

Background: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Molecular Weight: 60 kDa (MW of target protein)