NUP50 antibody (C-Term)

Catalog No. ABIN631630

Product Details anti-NUP50 Antibody

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP50 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP50 antibody was raised against the C terminal of NUP50

Purification: Affinity purified

Immunogen: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP50 Blocking Peptide, catalog no. 33R-9330, is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP50

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Alternative Name: NUP50 (NUP50 Products)

Synonyms: wu:fa56e03 antibody, wu:fb78a08 antibody, GB18194 antibody, npap60 antibody, npap60l antibody, Nup50 antibody, Rtp60 antibody, 1700030K07Rik antibody, AI413123 antibody, Npap60 antibody, NPAP60 antibody, NPAP60L antibody, nucleoporin 50 antibody, nuclear pore complex protein Nup50 antibody, nucleoporin 50kDa S homeolog antibody, nucleoporin 50kDa antibody, nup50 antibody, LOC410864 antibody, NUP50 antibody, nup50.S antibody, CpipJ_CPIJ012737 antibody, Nup50 antibody

Background: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Tube Formation