PRAS40 antibody
-
- Target See all PRAS40 (AKT1S1) Antibodies
- PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRAS40 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE
- Top Product
- Discover our top product AKT1S1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
AKT1S1 Blocking Peptide, catalog no. 33R-4654, is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))
- Alternative Name
- AKT1S1 (AKT1S1 Products)
- Synonyms
- MGC81452 antibody, lobe antibody, pras40 antibody, fb34a04 antibody, wu:fb34a04 antibody, Lobe antibody, PRAS40 antibody, 1110012J22Rik antibody, AI227026 antibody, Lobel antibody, AKT1 substrate 1 (proline rich) S homeolog antibody, AKT1 substrate 1 antibody, AKT1 substrate 1 (proline rich) antibody, AKT1 substrate 1 (proline-rich) antibody, akt1s1.S antibody, AKT1S1 antibody, akt1s1 antibody, Akt1s1 antibody
- Background
- AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.
- Molecular Weight
- 27 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Cell Size, Autophagy, BCR Signaling, Warburg Effect
-