NKD1 antibody

Catalog No. ABIN631653

Product Details anti-NKD1 Antibody

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NKD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: NKD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPG

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NKD1 Blocking Peptide, catalog no. 33R-2577, is also available for use as a blocking control in assays to test for specificity of this NKD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NKD1

Target: NKD1 (Naked Cuticle Homolog 1 (NKD1))

Alternative Name: NKD1 (NKD1 Products)

Synonyms: 2810434J10Rik antibody, 9030215G15Rik antibody, Nkd antibody, Naked1 antibody, naked cuticle homolog 1 antibody, naked cuticle 1 homolog (Drosophila) antibody, naked cuticle homolog 1 (Drosophila) antibody, NKD1 antibody, Nkd1 antibody, nkd1 antibody

Background: In the mouse, NkDa is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.

Molecular Weight: 52 kDa (MW of target protein)