UBE2D3 antibody

Catalog No. ABIN631661

Product Details anti-UBE2D3 Antibody

Target: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2D3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UBE2 D3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2D3 Blocking Peptide, catalog no. 33R-5691, is also available for use as a blocking control in assays to test for specificity of this UBE2D3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2D3

Target: UBE2D3 (Ubiquitin-Conjugating Enzyme E2D 3 (UBE2D3))

Alternative Name: UBE2D3 (UBE2D3 Products)

Synonyms: E2(17)KB3 antibody, UBC4/5 antibody, UBCH5C antibody, eff antibody, fb36f02 antibody, wu:fb36f02 antibody, zgc:56340 antibody, 1100001F19Rik antibody, 9430029A22Rik antibody, AA414951 antibody, UBE2D3P antibody, Xubc4 antibody, e2(17)kb3 antibody, ubc4/5 antibody, ubch5c antibody, ube2d3.1 antibody, ube2d2 antibody, xubc4 antibody, wu:fj13d01 antibody, zgc:73200 antibody, ubiquitin conjugating enzyme E2 D3 antibody, ubiquitin-conjugating enzyme E2D 3 antibody, ubiquitin conjugating enzyme E2 D3 L homeolog antibody, ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast), like antibody, UBE2D3 antibody, ube2d3 antibody, Ube2d3 antibody, LOC100223566 antibody, ube2d3.L antibody, ube2d2l antibody

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Toll-Like Receptors Cascades