CEACAM6 antibody

Catalog No. ABIN631672

This Rabbit Polyclonal antibody specifically detects CEACAM6 in WB. It exhibits reactivity toward Human.

Quick Overview for CEACAM6 antibody (ABIN631672)

Target: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEACAM6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CEACAM6 Antibody

Purification: Affinity purified

Immunogen: CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CEACAM6 Blocking Peptide, (ABIN939930), is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CEACAM6

Target: CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))

Alternative Name: CEACAM6

Background: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo.

Molecular Weight: 33 kDa (MW of target protein)