PITPNB antibody (Middle Region)

Catalog No. ABIN631693

Product Details anti-PITPNB Antibody

Target: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PITPNB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PITPNB antibody was raised against the middle region of PITPNB

Purification: Affinity purified

Immunogen: PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PITPNB Blocking Peptide, catalog no. 33R-1104, is also available for use as a blocking control in assays to test for specificity of this PITPNB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PITPNB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PITPNB

Target: PITPNB (Phosphotidylinositol Transfer Protein, beta (PITPNB))

Alternative Name: PITPNB (PITPNB Products)

Background: PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Molecular Weight: 31 kDa (MW of target protein)