GGA3 antibody (N-Term)
-
- Target See all GGA3 Antibodies
- GGA3 (Golgi-Associated, gamma Adaptin Ear Containing, ARF Binding Protein 3 (GGA3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GGA3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GGA3 antibody was raised against the N terminal of GGA3
- Purification
- Affinity purified
- Immunogen
- GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
- Top Product
- Discover our top product GGA3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GGA3 Blocking Peptide, catalog no. 33R-1301, is also available for use as a blocking control in assays to test for specificity of this GGA3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GGA3 (Golgi-Associated, gamma Adaptin Ear Containing, ARF Binding Protein 3 (GGA3))
- Alternative Name
- GGA3 (GGA3 Products)
- Synonyms
- C230037M19Rik antibody, mKIAA0154 antibody, golgi associated, gamma adaptin ear containing, ARF binding protein 3 antibody, Gga3 antibody, GGA3 antibody
- Background
- This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome.
- Molecular Weight
- 78 kDa (MW of target protein)
-