GGA3 antibody (N-Term)

Catalog No. ABIN631698

The Rabbit Polyclonal anti-GGA3 antibody (ABIN631698) specifically detects GGA3 in WB. The antibody is reactive with Human samples.

Quick Overview for GGA3 antibody (N-Term) (ABIN631698)

Target: GGA3 (Golgi-Associated, gamma Adaptin Ear Containing, ARF Binding Protein 3 (GGA3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GGA3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GGA3 Antibody

Binding Specificity: N-Term

Specificity: GGA3 antibody was raised against the N terminal of GGA3

Purification: Affinity purified

Immunogen: GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GGA3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GGA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GGA3

Target: GGA3 (Golgi-Associated, gamma Adaptin Ear Containing, ARF Binding Protein 3 (GGA3))

Alternative Name: GGA3

Background: This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome.

Molecular Weight: 78 kDa (MW of target protein)