DENND1A antibody (N-Term)

Catalog No. ABIN631710

The Rabbit Polyclonal anti-DENND1A antibody (ABIN631710) specifically detects DENND1A in WB. The antibody is reactive with Human samples.

Quick Overview for DENND1A antibody (N-Term) (ABIN631710)

Target: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DENND1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DENND1A Antibody

Binding Specificity: N-Term

Specificity: DENND1 A antibody was raised against the N terminal of DENND1

Purification: Affinity purified

Immunogen: DENND1 A antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DENND1A Blocking Peptide, (ABIN5613177), is also available for use as a blocking control in assays to test for specificity of this DENND1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DENND1A

Target: DENND1A (DENN/MADD Domain Containing 1A (DENND1A))

Alternative Name: DENND1A

Background: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Molecular Weight: 110 kDa (MW of target protein)