TPRN antibody (Middle Region)

Catalog No. ABIN631720

This Rabbit Polyclonal antibody specifically detects TPRN in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TPRN antibody (Middle Region) (ABIN631720)

Target: TPRN (Taperin (TPRN))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPRN antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPRN Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF75 antibody was raised against the middle region of C9 rf75

Purification: Affinity purified

Immunogen: C9 ORF75 antibody was raised using the middle region of C9 rf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF75 Blocking Peptide, (ABIN937655), is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPRN

Target: TPRN (Taperin (TPRN))

Alternative Name: C9ORF75

Background: The specific function of C9orf75 is not yet known.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Sensory Perception of Sound