FBXO28 antibody (Middle Region)

Catalog No. ABIN631726

This Rabbit Polyclonal antibody specifically detects FBXO28 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FBXO28 antibody (Middle Region) (ABIN631726)

Target: FBXO28 (F-Box Protein 28 (FBXO28))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO28 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO28 Antibody

Binding Specificity: Middle Region

Specificity: FBXO28 antibody was raised against the middle region of FBXO28

Purification: Affinity purified

Immunogen: FBXO28 antibody was raised using the middle region of FBXO28 corresponding to a region with amino acids ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO28 Blocking Peptide, (ABIN937925), is also available for use as a blocking control in assays to test for specificity of this FBXO28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO28

Target: FBXO28 (F-Box Protein 28 (FBXO28))

Alternative Name: FBXO28

Background: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 41 kDa (MW of target protein)