TRAPPC6B antibody (Middle Region)

Catalog No. ABIN631728

Product Details anti-TRAPPC6B Antibody

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC6B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Purification: Affinity purified

Immunogen: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC6B Blocking Peptide, catalog no. 33R-9336, is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC6B

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Alternative Name: TRAPPC6B (TRAPPC6B Products)

Synonyms: zgc:103464 antibody, TPC6 antibody, 5830498C14Rik antibody, C79212 antibody, RGD1309325 antibody, trafficking protein particle complex 6b antibody, Trafficking protein particle complex subunit 6B antibody, trafficking protein particle complex subunit 6B antibody, trafficking protein particle complex subunit 6b antibody, trafficking protein particle complex 6B antibody, trafficking protein particle complex 6B L homeolog antibody, LOC733029 antibody, cgd3_2700 antibody, NCU06212 antibody, ATEG_05652 antibody, LOC5563708 antibody, CC1G_04333 antibody, CpipJ_CPIJ005932 antibody, PTRG_01279 antibody, TTHERM_00657360 antibody, PITG_00953 antibody, Tsp_08307 antibody, trappc6b antibody, trappc6b.L antibody, TRAPPC6B antibody, Trappc6b antibody

Background: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Molecular Weight: 15 kDa (MW of target protein)