VARS antibody (Middle Region)

Catalog No. ABIN631756

This Rabbit Polyclonal antibody specifically detects VARS in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for VARS antibody (Middle Region) (ABIN631756)

Target: VARS (Valyl-tRNA Synthetase (VARS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VARS antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VARS Antibody

Binding Specificity: Middle Region

Specificity: VARS antibody was raised against the middle region of VARS

Purification: Affinity purified

Immunogen: VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids VFDEFVDMDFGTGAVKITPAHDQNDYEVGQRHGLEAISIMDSRGALINVP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VARS Blocking Peptide, (ABIN5616945), is also available for use as a blocking control in assays to test for specificity of this VARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VARS

Target: VARS (Valyl-tRNA Synthetase (VARS))

Alternative Name: VARS

Background: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. VARS belongs to class-I aminoacyl-tRNA synthetase family and is located in the class III region of the major histocompatibility complex.

Molecular Weight: 140 kDa (MW of target protein)