HB (N-Term) antibody

Catalog No. ABIN631771

This Rabbit Polyclonal antibody specifically detects HB in WB. It exhibits reactivity toward Drosophila melanogaster.

Quick Overview for HB (N-Term) antibody (ABIN631771)

Target: HB

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: HB antibody was raised against the N terminal Of Hb

Purification: Affinity purified

Immunogen: HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HB Blocking Peptide, (ABIN5613938), is also available for use as a blocking control in assays to test for specificity of this HB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: HB

Background: Hb is a gap class segmentation protein that controls development of head structures.

Molecular Weight: 83 kDa (MW of target protein)