KRT17 antibody (C-Term)

Catalog No. ABIN631802

Product Details anti-KRT17 Antibody

Target: KRT17 (Keratin 17 (KRT17))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT17 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Cytokeratin 17 antibody was raised against the C terminal of KRT17

Purification: Affinity purified

Immunogen: Cytokeratin 17 antibody was raised using the C terminal of KRT17 corresponding to a region with amino acids IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 17 Blocking Peptide, catalog no. 33R-3900, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT17

Target: KRT17 (Keratin 17 (KRT17))

Alternative Name: Cytokeratin 17 (KRT17 Products)

Synonyms: K17 antibody, Krt1-17 antibody, PC antibody, PC2 antibody, PCHC1 antibody, Ka17 antibody, KRT17 antibody, krt16 antibody, si:dkeyp-113d7.7 antibody, KRT14 antibody, keratin 17 antibody, keratin 17 L homeolog antibody, keratin 17, type I antibody, keratin, type I cytoskeletal 17 antibody, Krt17 antibody, KRT17 antibody, krt17 antibody, krt17.L antibody, LOC100737113 antibody, LOC102177275 antibody

Background: KRT17 is type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in its gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.KRT17 encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.

Molecular Weight: 48 kDa (MW of target protein)