ANKLE2 antibody (Middle Region)

Catalog No. ABIN631827

This anti-ANKLE2 antibody is a Rabbit Polyclonal antibody detecting ANKLE2 in WB. Suitable for Human.

Quick Overview for ANKLE2 antibody (Middle Region) (ABIN631827)

Target: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKLE2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANKLE2 Antibody

Binding Specificity: Middle Region

Specificity: KIAA0692 antibody was raised against the middle region of Kiaa0692

Purification: Affinity purified

Immunogen: KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0692 Blocking Peptide, (ABIN937225), is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKLE2

Target: ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))

Alternative Name: KIAA0692

Background: KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.

Molecular Weight: 104 kDa (MW of target protein)