DCXR antibody (Middle Region)

Catalog No. ABIN631837

This Rabbit Polyclonal antibody specifically detects DCXR in WB and IHC. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DCXR antibody (Middle Region) (ABIN631837)

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCXR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-DCXR Antibody

Binding Specificity: Middle Region

Specificity: DCXR antibody was raised against the middle region of DCXR

Purification: Affinity purified

Immunogen: DCXR antibody was raised using the middle region of DCXR corresponding to a region with amino acids STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCXR Blocking Peptide, (ABIN5613147), is also available for use as a blocking control in assays to test for specificity of this DCXR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCXR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCXR

Target: DCXR (Dicarbonyl/L-Xylulose Reductase (DCXR))

Alternative Name: DCXR

Background: DCXR is an enzyme that has both diacetyl reductase and L-xylulose reductase activities.DCXR is an enzyme that has both diacetyl reductase (EC 1.1.1.5) and L-xylulose reductase (EC 1.1.1.10) activities.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Monocarboxylic Acid Catabolic Process