Phosphoglucomutase 3 antibody (Middle Region)

Catalog No. ABIN631841

Product Details anti-Phosphoglucomutase 3 Antibody

Target: Phosphoglucomutase 3 (PGM3)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Phosphoglucomutase 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PGM3 antibody was raised against the middle region of PGM3

Purification: Affinity purified

Immunogen: PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGM3 Blocking Peptide, catalog no. 33R-3660, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Phosphoglucomutase 3

Target: Phosphoglucomutase 3 (PGM3)

Alternative Name: PGM3 (PGM3 Products)

Synonyms: pgm3 antibody, MGC69105 antibody, wu:fc08c11 antibody, wu:fc39c03 antibody, zgc:91932 antibody, PGM3 antibody, AGM1 antibody, PAGM antibody, PGM 3 antibody, 2810473H05Rik antibody, Agm1 antibody, BB187688 antibody, C77933 antibody, Pgm-3 antibody, phosphoglucomutase 3 L homeolog antibody, phosphoglucomutase 3 antibody, phosphoacetylglucosamine mutase antibody, pgm3.L antibody, PGM3 antibody, pgm3 antibody, PGTG_05011 antibody, Pgm3 antibody

Background: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Molecular Weight: 60 kDa (MW of target protein)