SKA3 antibody (Middle Region)

Catalog No. ABIN631843

Product Details anti-SKA3 Antibody

Target: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SKA3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SKA3 antibody was raised against the middle region of SKA3

Purification: Affinity purified

Immunogen: SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SKA3

Target: SKA3 (Spindle and Kinetochore Associated Complex Subunit 3 (SKA3))

Alternative Name: SKA3 (SKA3 Products)

Synonyms: C13orf3 antibody, RAMA1 antibody, RGD1307201 antibody, C12H13ORF3 antibody, fc23d11 antibody, si:rp71-68n21.13 antibody, wu:fc23d11 antibody, rama1 antibody, F630043A04Rik antibody, spindle and kinetochore associated complex subunit 3 antibody, spindle and kinetochore associated complex subunit 3 L homeolog antibody, SKA3 antibody, Ska3 antibody, ska3 antibody, ska3.L antibody

Background: This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.

Molecular Weight: 46 kDa (MW of target protein)