DPPA4 antibody (N-Term)

Catalog No. ABIN631866

This anti-DPPA4 antibody is a Rabbit Polyclonal antibody detecting DPPA4 in WB. Suitable for Human.

Quick Overview for DPPA4 antibody (N-Term) (ABIN631866)

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DPPA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DPPA4 Antibody

Binding Specificity: N-Term

Specificity: DPPA4 antibody was raised against the N terminal of DPPA4

Purification: Affinity purified

Immunogen: DPPA4 antibody was raised using the N terminal of DPPA4 corresponding to a region with amino acids MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPPA4 Blocking Peptide, (ABIN5613251), is also available for use as a blocking control in assays to test for specificity of this DPPA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DPPA4

Target: DPPA4 (Developmental Pluripotency Associated 4 (DPPA4))

Alternative Name: DPPA4

Background: DPPA4 may play a role in maintaining cell pluripotentiality.

Molecular Weight: 33 kDa (MW of target protein)