RAD23B antibody

Catalog No. ABIN631882

This Rabbit Polyclonal antibody specifically detects RAD23B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RAD23B antibody (ABIN631882)

Target: RAD23B (RAD23 Homolog B (RAD23B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAD23B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAD23B Antibody

Purification: Affinity purified

Immunogen: RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAD23B Blocking Peptide, (ABIN5615732), is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAD23B

Target: RAD23B (RAD23 Homolog B (RAD23B))

Alternative Name: RAD23B

Background: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).

Molecular Weight: 43 kDa (MW of target protein)

Pathways: DNA Damage Repair