RAD23B antibody
-
- Target See all RAD23B Antibodies
- RAD23B (RAD23 Homolog B (RAD23B))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAD23B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RAD23 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG
- Top Product
- Discover our top product RAD23B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAD23B Blocking Peptide, catalog no. 33R-7658, is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAD20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD23B (RAD23 Homolog B (RAD23B))
- Alternative Name
- RAD23B (RAD23B Products)
- Background
- The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-