ACTR3 antibody
-
- Target See all ACTR3 Antibodies
- ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACTR3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACTR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE
- Top Product
- Discover our top product ACTR3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACTR3 Blocking Peptide, catalog no. 33R-3891, is also available for use as a blocking control in assays to test for specificity of this ACTR3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR3 (ARP3 Actin-Related Protein 3 (ACTR3))
- Alternative Name
- ACTR3 (ACTR3 Products)
- Background
- The specific function of this gene has not yet been determined, however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.
- Molecular Weight
- 47 kDa (MW of target protein)
- Pathways
- RTK Signaling, Regulation of Actin Filament Polymerization
-