DOK5 antibody (N-Term)

Catalog No. ABIN631914

This anti-DOK5 antibody is a Rabbit Polyclonal antibody detecting DOK5 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DOK5 antibody (N-Term) (ABIN631914)

Target: DOK5 (Docking Protein 5 (DOK5))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DOK5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DOK5 Antibody

Binding Specificity: N-Term

Specificity: DOK5 antibody was raised against the N terminal of DOK5

Purification: Affinity purified

Immunogen: DOK5 antibody was raised using the N terminal of DOK5 corresponding to a region with amino acids GPKRLEKFSDERAAYFRCYHKVTELNNVKNVARLPKSTKKHAIGIYFNDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DOK5 Blocking Peptide, (ABIN938860), is also available for use as a blocking control in assays to test for specificity of this DOK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DOK5

Target: DOK5 (Docking Protein 5 (DOK5))

Alternative Name: DOK5

Background: DOK5 is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. It interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. In contrast to other DOK family proteins, this protein does not interact with RASGAP.

Molecular Weight: 34 kDa (MW of target protein)