PFDN6 antibody (N-Term)

Catalog No. ABIN631922

Product Details anti-PFDN6 Antibody

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PFDN6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PFDN6 antibody was raised against the N terminal of PFDN6

Purification: Affinity purified

Immunogen: PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PFDN6 Blocking Peptide, catalog no. 33R-5640, is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFDN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PFDN6

Target: PFDN6 (Prefoldin Subunit 6 (PFDN6))

Alternative Name: PFDN6 (PFDN6 Products)

Synonyms: hke2 antibody, ke-2 antibody, pfd6 antibody, h2-ke2 antibody, pfdn6a antibody, 23.m05913 antibody, H-2Ke2 antibody, Ke-2 antibody, Pfdn6 antibody, H2-KE2 antibody, HKE2 antibody, KE-2 antibody, PFD6 antibody, zgc:66282 antibody, pfdn6 antibody, pfdn6b antibody, Ke2 antibody, prefoldin subunit 6 S homeolog antibody, prefoldin subunit 6 (predicted) antibody, prefoldin subunit 6 antibody, prefoldin subunit 6 L homeolog antibody, pfdn6.S antibody, SPAC3A11.13 antibody, BBOV_IV004800 antibody, AOR_1_2254174 antibody, CMU_042830 antibody, pfdn6 antibody, Pfdn6 antibody, PFDN6 antibody, pfdn6.L antibody

Background: PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Unfolded Protein Response