NRARP antibody (Middle Region)

Catalog No. ABIN631926

The Rabbit Polyclonal anti-NRARP antibody (ABIN631926) specifically detects NRARP in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for NRARP antibody (Middle Region) (ABIN631926)

Target: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NRARP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NRARP Antibody

Binding Specificity: Middle Region

Specificity: NRARP antibody was raised against the middle region of NRARP

Purification: Affinity purified

Immunogen: NRARP antibody was raised using the middle region of NRARP corresponding to a region with amino acids QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRARP Blocking Peptide, (ABIN5615058), is also available for use as a blocking control in assays to test for specificity of this NRARP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NRARP

Target: NRARP (NOTCH-Regulated Ankyrin Repeat Protein (NRARP))

Alternative Name: NRARP

Background: NRARP may play a role in the formation of somites.

Molecular Weight: 12 kDa (MW of target protein)