PARP12 antibody
-
- Target See all PARP12 products
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PARP12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSL
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PARP12 Blocking Peptide, catalog no. 33R-3134, is also available for use as a blocking control in assays to test for specificity of this PARP12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARP12 (Poly (ADP-Ribose) Polymerase Family, Member 12 (PARP12))
- Alternative Name
- PARP12 (PARP12 Products)
- Synonyms
- ARTD12 antibody, MST109 antibody, MSTP109 antibody, ZC3H1 antibody, ZC3HDC1 antibody, 9930021O16 antibody, AA409132 antibody, AA536654 antibody, PARP-12 antibody, Zc3hdc1 antibody, PARP12 antibody, zc3h1 antibody, mst109 antibody, mstp109 antibody, zc3hdc1 antibody, si:ch211-227d19.2 antibody, poly(ADP-ribose) polymerase family member 12 antibody, poly (ADP-ribose) polymerase family, member 12 antibody, poly(ADP-ribose) polymerase family member 12 L homeolog antibody, poly (ADP-ribose) polymerase family, member 12a antibody, poly [ADP-ribose] polymerase 12 antibody, PARP12 antibody, Parp12 antibody, parp12.L antibody, parp12a antibody, parp12 antibody, LOC100561568 antibody
- Background
- The function of PARP12 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 79 kDa (MW of target protein)
-