NMRAL1 antibody (Middle Region)

Catalog No. ABIN631947

The Rabbit Polyclonal anti-NMRAL1 antibody (ABIN631947) specifically detects NMRAL1 in WB. The antibody is reactive with Human samples.

Quick Overview for NMRAL1 antibody (Middle Region) (ABIN631947)

Target: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NMRAL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NMRAL1 Antibody

Binding Specificity: Middle Region

Specificity: NMRAL1 antibody was raised against the middle region of NMRAL1

Purification: Affinity purified

Immunogen: NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NMRAL1 Blocking Peptide, (ABIN5615011), is also available for use as a blocking control in assays to test for specificity of this NMRAL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMRAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NMRAL1

Target: NMRAL1 (NmrA-Like Family Domain Containing 1 (NMRAL1))

Alternative Name: NMRAL1

Background: The function of this protein is binding, oxidoreductase activity and transcription repressor activity.

Molecular Weight: 33 kDa (MW of target protein)