ANKRD2 antibody

Catalog No. ABIN631951

Product Details anti-ANKRD2 Antibody

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD2 Blocking Peptide, catalog no. 33R-7516, is also available for use as a blocking control in assays to test for specificity of this ANKRD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD2

Target: ANKRD2 (Ankyrin Repeat Domain 2 (Stretch Responsive Muscle) (ANKRD2))

Alternative Name: ANKRD2 (ANKRD2 Products)

Synonyms: ANKRD2 antibody, ankrd2-a antibody, MGC52621 antibody, ankrd2-b antibody, MGC83036 antibody, ARPP antibody, Arpp antibody, mArpp antibody, AFT antibody, AKR2A antibody, F15J1.20 antibody, F15J1_20 antibody, ankyrin repeat-containing protein 2 antibody, ankyrin repeat domain 2 antibody, ankyrin repeat domain 2 (stretch responsive muscle) antibody, ankyrin repeat domain 2 (stretch responsive muscle) L homeolog antibody, ankyrin repeat domain 2 (stretch responsive muscle) S homeolog antibody, ankyrin repeat-containing protein 2 antibody, ANKRD2 antibody, ankrd2 antibody, ankrd2.L antibody, ankrd2.S antibody, Ankrd2 antibody, AKR2 antibody

Background: ANKRD2 may play an important role in skeletal muscle hypertrophy.

Molecular Weight: 49 kDa (MW of target protein)