WDR1 antibody (N-Term)

Catalog No. ABIN631958

The Rabbit Polyclonal anti-WDR1 antibody has been validated for WB. It is suitable to detect WDR1 in samples from Human.

Quick Overview for WDR1 antibody (N-Term) (ABIN631958)

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR1 Antibody

Binding Specificity: N-Term

Specificity: WDR1 antibody was raised against the N terminal of WDR1

Purification: Affinity purified

Immunogen: WDR1 antibody was raised using the N terminal of WDR1 corresponding to a region with amino acids DIAWTEDSKRIAVVGEGREKFGAVFLWDSGSSVGEITGHNKVINSVDIKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR1 Blocking Peptide, (ABIN937374), is also available for use as a blocking control in assays to test for specificity of this WDR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR1

Target: WDR1 (WD Repeat Domain 1 (WDR1))

Alternative Name: WDR1

Background: WDR1 is a protein containing 9 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WD domains are involved in protein-protein interactions. WDR1 may help induce the disassembly of actin filaments.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Sensory Perception of Sound