BRIX1 antibody (Middle Region)

Catalog No. ABIN631990

This Rabbit Polyclonal antibody specifically detects BRIX1 in WB. It exhibits reactivity toward Human.

Quick Overview for BRIX1 antibody (Middle Region) (ABIN631990)

Target: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRIX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BRIX1 Antibody

Binding Specificity: Middle Region

Specificity: BXDC2 antibody was raised against the middle region of Bxdc2

Purification: Affinity purified

Immunogen: BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BXDC2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRIX1

Target: BRIX1 (BRX1, Biogenesis of Ribosomes, Homolog (BRIX1))

Alternative Name: BXDC2

Background: BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Molecular Weight: 41 kDa (MW of target protein)