AP2B1 antibody (Middle Region)

Catalog No. ABIN631995

The Rabbit Polyclonal anti-AP2B1 antibody (ABIN631995) specifically detects AP2B1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for AP2B1 antibody (Middle Region) (ABIN631995)

Target: AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AP2B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AP2B1 Antibody

Binding Specificity: Middle Region

Specificity: AP2 B1 antibody was raised against the middle region of AP2 1

Purification: Affinity purified

Immunogen: AP2 B1 antibody was raised using the middle region of AP2 1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AP2B1 Blocking Peptide, (ABIN5612097), is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AP2B1

Target: AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))

Alternative Name: AP2B1

Background: AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation