EIF2AK1 antibody (N-Term)

Catalog No. ABIN631998

Product Details anti-EIF2AK1 Antibody

Target: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2AK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF2 AK1 antibody was raised against the N terminal of EIF2 K1

Purification: Affinity purified

Immunogen: EIF2 AK1 antibody was raised using the N terminal of EIF2 K1 corresponding to a region with amino acids TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2AK1 Blocking Peptide, catalog no. 33R-9000, is also available for use as a blocking control in assays to test for specificity of this EIF2AK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 K1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2AK1

Target: EIF2AK1 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 1 (EIF2AK1))

Alternative Name: EIF2AK1 (EIF2AK1 Products)

Synonyms: HCR antibody, Hri antibody, HRI antibody, wu:fj97h09 antibody, zgc:153232 antibody, eukaryotic translation initiation factor 2 alpha kinase 1 antibody, eukaryotic translation initiation factor 2-alpha kinase 1 antibody, eukaryotic translation initiation factor 2 alpha kinase 1 L homeolog antibody, EIF2AK1 antibody, eif2ak1 antibody, Eif2ak1 antibody, eif2ak1.L antibody

Background: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Hepatitis C