FBXO39 antibody (N-Term)

Catalog No. ABIN632003

The Rabbit Polyclonal anti-FBXO39 antibody has been validated for WB. It is suitable to detect FBXO39 in samples from Human.

Quick Overview for FBXO39 antibody (N-Term) (ABIN632003)

Target: FBXO39 (F-Box Protein 39 (FBXO39))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO39 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO39 Antibody

Binding Specificity: N-Term

Specificity: FBXO39 antibody was raised against the N terminal of FBXO39

Purification: Affinity purified

Immunogen: FBXO39 antibody was raised using the N terminal of FBXO39 corresponding to a region with amino acids DRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO39 Blocking Peptide, (ABIN937537), is also available for use as a blocking control in assays to test for specificity of this FBXO39 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO39

Target: FBXO39 (F-Box Protein 39 (FBXO39))

Alternative Name: FBXO39

Background: FBXO39 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 53 kDa (MW of target protein)