Dystrobrevin beta antibody (C-Term)

Catalog No. ABIN632005

Product Details anti-Dystrobrevin beta Antibody

Target: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Dystrobrevin beta antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DTNB antibody was raised against the C terminal of DTNB

Purification: Affinity purified

Immunogen: DTNB antibody was raised using the C terminal of DTNB corresponding to a region with amino acids ASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DTNB Blocking Peptide, catalog no. 33R-1524, is also available for use as a blocking control in assays to test for specificity of this DTNB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTNB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Dystrobrevin beta

Target: Dystrobrevin beta (DTNB) (Dystrobrevin, beta (DTNB))

Alternative Name: DTNB (DTNB Products)

Synonyms: DTNB antibody, bdtn antibody, btnb antibody, dtnb antibody, GDTN antibody, dtng antibody, gtnb antibody, wu:fc61h11 antibody, dystrobrevin beta antibody, dystrobrevin, beta b antibody, dystrobrevin, beta antibody, dystrobrevin, beta a antibody, DTNB antibody, dtnbb antibody, Dtnb antibody, dtnba antibody, dtnb antibody

Background: DTNB is dystrobrevin beta, a component of the dystrophin-associated protein complex (DPC). The DPC consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and dystrobrevin alpha and beta. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Dystrobrevin beta is thought to interact with syntrophin and the DP71 short form of dystrophin.

Molecular Weight: 64 kDa (MW of target protein)