UCK2 antibody (N-Term)

Catalog No. ABIN632007

Product Details anti-UCK2 Antibody

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UCK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UCK2 antibody was raised against the N terminal of UCK2

Purification: Affinity purified

Immunogen: UCK2 antibody was raised using the N terminal of UCK2 corresponding to a region with amino acids AGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCK2 Blocking Peptide, catalog no. 33R-1189, is also available for use as a blocking control in assays to test for specificity of this UCK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UCK2

Target: UCK2 (Uridine-Cytidine Kinase 2 (UCK2))

Alternative Name: UCK2 (UCK2 Products)

Synonyms: TSA903 antibody, UK antibody, UMPK antibody, AA407809 antibody, AI481316 antibody, AU018180 antibody, AU020720 antibody, UMK antibody, Umpk antibody, wu:fa20g04 antibody, zgc:56174 antibody, UCK2 antibody, DDBDRAFT_0202355 antibody, DDBDRAFT_0216233 antibody, DDB_0202355 antibody, DDB_0216233 antibody, DDBDRAFT_0167798 antibody, DDBDRAFT_0230208 antibody, DDB_0167798 antibody, DDB_0230208 antibody, UCK 2-A antibody, umpk antibody, wu:fk91a01 antibody, zgc:66240 antibody, uridine-cytidine kinase 2 antibody, uridine-cytidine kinase 2b antibody, microRNA 3658 antibody, uridine-cytidine kinase 2 S homeolog antibody, uridine kinase antibody, Uridine kinase antibody, toxin secretion ABC transporter ATP-binding protein antibody, uridine-cytidine kinase 2a antibody, UCK2 antibody, Uck2 antibody, uck2b antibody, MIR3658 antibody, uck2.S antibody, LOC692983 antibody, PTRG_08949 antibody, udkA antibody, udkB antibody, Mrub_2364 antibody, Mesil_2200 antibody, Spirs_2239 antibody, Tmar_0146 antibody, Bache_3005 antibody, Celal_2781 antibody, Deima_0461 antibody, Odosp_0439 antibody, Bacsa_1376 antibody, Celly_0243 antibody, Weevi_1813 antibody, Marky_0973 antibody, Spico_0967 antibody, Poras_0295 antibody, Theth_1915 antibody, uck2 antibody, XCC1480 antibody, uck2a antibody

Background: UCK2 catalyzes the phosphorylation of uridine monophosphate to uridine diphosphate. This is the first step in the production of the pyrimidine nucleoside triphosphates required for RNA and DNA synthesis. In addition, an allele of this gene may play a role in mediating nonhumoral immunity to Hemophilus influenzae type B.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Feeding Behaviour