AKAP10 antibody

Catalog No. ABIN632020

This Rabbit Polyclonal antibody specifically detects AKAP10 in WB. It exhibits reactivity toward Human.

Quick Overview for AKAP10 antibody (ABIN632020)

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AKAP10 Antibody

Purification: Affinity purified

Immunogen: AKAP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP10 Blocking Peptide, (ABIN938121), is also available for use as a blocking control in assays to test for specificity of this AKAP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP10

Target: AKAP10 (A Kinase (PRKA) Anchor Protein 10 (AKAP10))

Alternative Name: AKAP10

Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA, therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS (regulator of G protein signalling) domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling