AGO1 antibody (N-Term)

Catalog No. ABIN632044

This Rabbit Polyclonal antibody specifically detects AGO1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for AGO1 antibody (N-Term) (ABIN632044)

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AGO1 Antibody

Binding Specificity: N-Term

Specificity: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogen: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2C1 Blocking Peptide, (ABIN5613323), is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGO1

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Alternative Name: EIF2C1

Background: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization