AGO1 antibody (N-Term)

Catalog No. ABIN632044

Product Details anti-AGO1 Antibody

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGO1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF2 C1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogen: EIF2 C1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2C1 Blocking Peptide, catalog no. 33R-5890, is also available for use as a blocking control in assays to test for specificity of this EIF2C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGO1

Target: AGO1 (EIF2C1) (Eukaryotic Translation Initiation Factor 2C, 1 (EIF2C1))

Alternative Name: EIF2C1 (EIF2C1 Products)

Synonyms: Ago antibody, Ago-1 antibody, Ago1 antibody, CG6671 antibody, Dm Ago1 antibody, Dmel\\CG6671 antibody, MRE20 antibody, ago1 antibody, ago1-1 antibody, anon-WO0257455.29 antibody, dAGO1 antibody, dAgo1 antibody, l(2)04845 antibody, l(2)4845 antibody, l(2)k00208 antibody, l(2)k08121 antibody, GB12654 antibody, dsim_GLEANR_9718 antibody, DsimGD25729 antibody, GD25729 antibody, EIF2C1 antibody, EIF2C antibody, GERP95 antibody, Q99 antibody, Eif2c1 antibody, ARGONAUTE 1 antibody, T1N15.2 antibody, T1N15_2 antibody, Argonaute-1 antibody, protein argonaute-2 antibody, argonaute 1 antibody, Argonaute 1 antibody, protein argonaute-1 antibody, argonaute 1, RISC catalytic component antibody, argonaute RISC catalytic subunit 1 antibody, Stabilizer of iron transporter SufD / Polynucleotidyl transferase antibody, AGO1 antibody, LOC552062 antibody, ago1 antibody, LOC659936 antibody, Dsim\AGO1 antibody, Ago1 antibody, LOC100386910 antibody, LOC100482671 antibody, LOC475337 antibody

Background: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hormone Transport, Regulation of Actin Filament Polymerization, Stem Cell Maintenance, Ribonucleoprotein Complex Subunit Organization