UEVLD antibody (N-Term)

Catalog No. ABIN632053

Product Details anti-UEVLD Antibody

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UEVLD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UEVLD antibody was raised against the N terminal of UEVLD

Purification: Affinity purified

Immunogen: UEVLD antibody was raised using the N terminal of UEVLD corresponding to a region with amino acids FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UEVLD Blocking Peptide, catalog no. 33R-2953, is also available for use as a blocking control in assays to test for specificity of this UEVLD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UEVLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UEVLD

Target: UEVLD (UEV and Lactate/malate Dehyrogenase Domains (UEVLD))

Alternative Name: UEVLD (UEVLD Products)

Synonyms: ATTP antibody, UEV3 antibody, 8430408E05Rik antibody, Attp antibody, UEV and lactate/malate dehyrogenase domains antibody, UEVLD antibody, Uevld antibody

Background: UEVLD is a possible negative regulator of polyubiquitination.

Molecular Weight: 42 kDa (MW of target protein)