VPS53 antibody

Catalog No. ABIN632054

The Rabbit Polyclonal anti-VPS53 antibody is suitable to detect VPS53 in samples from Human. It has been validated for WB.

Quick Overview for VPS53 antibody (ABIN632054)

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VPS53 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VPS53 Antibody

Purification: Affinity purified

Immunogen: VPS53 antibody was raised using a synthetic peptide corresponding to a region with amino acids VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VPS53 Blocking Peptide, (ABIN5616982), is also available for use as a blocking control in assays to test for specificity of this VPS53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VPS53

Target: VPS53 (Vacuolar Protein Sorting 53 Homolog (VPS53))

Alternative Name: VPS53

Background: This gene encodes a protein with sequence similarity to the yeast Vps53p protein. Vps53p is involved in retrograde vesicle trafficking in late Golgi.

Molecular Weight: 92 kDa (MW of target protein)