Schlafen-Like 1 antibody (Middle Region)

Catalog No. ABIN632057

Product Details anti-Schlafen-Like 1 Antibody

Target: Schlafen-Like 1 (SLFNL1)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Schlafen-Like 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLFNL1 antibody was raised against the middle region of SLFNL1

Purification: Affinity purified

Immunogen: SLFNL1 antibody was raised using the middle region of SLFNL1 corresponding to a region with amino acids TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLFNL1 Blocking Peptide, catalog no. 33R-9355, is also available for use as a blocking control in assays to test for specificity of this SLFNL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLFNL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Schlafen-Like 1

Target: Schlafen-Like 1 (SLFNL1)

Alternative Name: SLFNL1 (SLFNL1 Products)

Synonyms: 4933406A14Rik antibody, schlafen like 1 antibody, schlafen-like 1 antibody, SLFNL1 antibody, Slfnl1 antibody

Background: SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.

Molecular Weight: 45 kDa (MW of target protein)