MAP3K14 antibody (N-Term)

Catalog No. ABIN632058

This anti-MAP3K14 antibody is a Rabbit Polyclonal antibody detecting MAP3K14 in WB. Suitable for Human.

Quick Overview for MAP3K14 antibody (N-Term) (ABIN632058)

Target: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP3K14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP3K14 Antibody

Binding Specificity: N-Term

Specificity: MAP3 K14 antibody was raised against the N terminal of MAP3 14

Purification: Affinity purified

Immunogen: MAP3 K14 antibody was raised using the N terminal of MAP3 14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP3K14 Blocking Peptide, (ABIN5614651), is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP3K14

Target: MAP3K14 (Mitogen-Activated Protein Kinase Kinase Kinase 14 (MAP3K14))

Alternative Name: MAP3K14

Background: This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

Molecular Weight: 104 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, TCR Signaling