NECAB3 antibody (N-Term)

Catalog No. ABIN632067

This anti-NECAB3 antibody is a Rabbit Polyclonal antibody detecting NECAB3 in WB. Suitable for Human.

Quick Overview for NECAB3 antibody (N-Term) (ABIN632067)

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NECAB3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NECAB3 Antibody

Binding Specificity: N-Term

Specificity: NECAB3 antibody was raised against the N terminal of NECAB3

Purification: Affinity purified

Immunogen: NECAB3 antibody was raised using the N terminal of NECAB3 corresponding to a region with amino acids MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NECAB3 Blocking Peptide, (ABIN5614947), is also available for use as a blocking control in assays to test for specificity of this NECAB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NECAB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NECAB3

Target: NECAB3 (N-Terminal EF-Hand Calcium Binding Protein 3 (NECAB3))

Alternative Name: NECAB3

Background: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 44 kDa (MW of target protein)