FABP1 antibody (N-Term)

Catalog No. ABIN632091

This anti-FABP1 antibody is a Rabbit Polyclonal antibody detecting FABP1 in WB. Suitable for Human and Mouse.

Quick Overview for FABP1 antibody (N-Term) (ABIN632091)

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FABP1 Antibody

Binding Specificity: N-Term

Specificity: FABP1 antibody was raised against the N terminal of FABP1

Purification: Affinity purified

Immunogen: FABP1 antibody was raised using the N terminal of FABP1 corresponding to a region with amino acids MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FABP1 Blocking Peptide, (ABIN5613445), is also available for use as a blocking control in assays to test for specificity of this FABP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FABP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FABP1

Target: FABP1 (Fatty Acid Binding Protein 1, Liver (FABP1))

Alternative Name: FABP1

Background: FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha