MDP1 antibody (N-Term)

Catalog No. ABIN632094

Product Details anti-MDP1 Antibody

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MDP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MDP1 antibody was raised against the N terminal Of Mdp-1

Purification: Affinity purified

Immunogen: MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MDP1 Blocking Peptide, catalog no. 33R-5731, is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDP-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MDP1

Target: MDP1 (Magnesium-Dependent Phosphatase 1 (MDP1))

Alternative Name: MDP1 (MDP1 Products)

Synonyms: MGC133592 antibody, FN6PASE antibody, MDP-1 antibody, 1810034K20Rik antibody, AI035604 antibody, Mdp-1 antibody, RGD1311147 antibody, magnesium-dependent phosphatase 1 antibody, magnesium dependent phosphatase 1 antibody, Magnesium-dependent phosphatase 1 antibody, LOC480264 antibody, MDP1 antibody, Mdp1 antibody, mgdp1 antibody

Background: MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Molecular Weight: 20 kDa (MW of target protein)