WDTC1 antibody (N-Term)

Catalog No. ABIN632114

The Rabbit Polyclonal anti-WDTC1 antibody is suitable to detect WDTC1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for WDTC1 antibody (N-Term) (ABIN632114)

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDTC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDTC1 Antibody

Binding Specificity: N-Term

Specificity: WDTC1 antibody was raised against the N terminal of WDTC1

Purification: Affinity purified

Immunogen: WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDTC1 Blocking Peptide, (ABIN5617007), is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDTC1

Target: WDTC1 (Wdtc1) (WD and Tetratricopeptide Repeats 1 (Wdtc1))

Alternative Name: WDTC1

Background: WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

Molecular Weight: 76 kDa (MW of target protein)