SSBP3 antibody (Middle Region)

Catalog No. ABIN632119

This Rabbit Polyclonal antibody specifically detects SSBP3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for SSBP3 antibody (Middle Region) (ABIN632119)

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSBP3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SSBP3 Antibody

Binding Specificity: Middle Region

Specificity: SSBP3 antibody was raised against the middle region of SSBP3

Purification: Affinity purified

Immunogen: SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSBP3 Blocking Peptide, (ABIN937376), is also available for use as a blocking control in assays to test for specificity of this SSBP3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSBP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSBP3

Target: SSBP3 (Single Stranded DNA Binding Protein 3 (SSBP3))

Alternative Name: SSBP3

Background: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Molecular Weight: 38 kDa (MW of target protein)