UFSP2 antibody (Middle Region)

Catalog No. ABIN632121

Product Details anti-UFSP2 Antibody

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UFSP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 ORF20 antibody was raised against the middle region of C4 rf20

Purification: Affinity purified

Immunogen: C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF20 Blocking Peptide, catalog no. 33R-9238, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UFSP2

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Alternative Name: C4ORF20 (C4orf20 Products)

Synonyms: C4orf20 antibody, 1810047C23Rik antibody, RGD1311161 antibody, cb891 antibody, fb05c06 antibody, fk89d04 antibody, wu:fb05c06 antibody, wu:fk89d04 antibody, zgc:64113 antibody, UFM1 specific peptidase 2 antibody, UFM1-specific peptidase 2 antibody, UFM1-specific peptidase 2 L homeolog antibody, ufm1-specific peptidase 2 antibody, UFSP2 antibody, Ufsp2 antibody, ufsp2.L antibody, ufsp2 antibody

Background: C4ORF20 is a thiol protease which recognises and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, an ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins.

Molecular Weight: 53 kDa (MW of target protein)